PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_03886.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 247aa    MW: 29218.2 Da    PI: 8.6438
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_03886.1_g00002.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.86.2e-51121362128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                               pGfrFhPtdeelv +yL++kve+k++++ e ik++diyk++PwdLp   k ++kewyfF+ r +ky+++ r+nr+tksg+Wkatg
  Sme2.5_03886.1_g00002.1  12 LPGFRFHPTDEELVGFYLRRKVENKRINI-ELIKQIDIYKYDPWDLP---KVGDKEWYFFCMRGRKYKNSVRPNRVTKSGFWKATG 93 
                              69***************************.89***************...4489******************************** PP

                      NAM  88 kdkevlskkgel..vglkktLvfykgrapkgektdWvmheyrl 128
                               dk+v+s++++   +glkk Lv+y+g+a kg+ktdW+mhe+rl
  Sme2.5_03886.1_g00002.1  94 IDKPVYSTQQQCciIGLKKCLVYYRGSAGKGTKTDWMMHEFRL 136
                              *******6554477***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-5410154IPR003441NAC domain
PROSITE profilePS5100553.35511155IPR003441NAC domain
PfamPF023652.7E-2613136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MSKEENEEDV ILPGFRFHPT DEELVGFYLR RKVENKRINI ELIKQIDIYK YDPWDLPKVG  60
DKEWYFFCMR GRKYKNSVRP NRVTKSGFWK ATGIDKPVYS TQQQCCIIGL KKCLVYYRGS  120
AGKGTKTDWM MHEFRLPPTS NPHAEVWTLC RILKRTSKRS SSYNTQEVMK HPISFKDMTF  180
QQENYNNYAA QMDEIRNQQN LISLESTLAS SSSSFWNTNS QEEYLLSDNY ENKWDDLKSI  240
VDLATMM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-481315719167NO APICAL MERISTEM PROTEIN
1ut4_B5e-481315719167NO APICAL MERISTEM PROTEIN
1ut7_A5e-481315719167NO APICAL MERISTEM PROTEIN
1ut7_B5e-481315719167NO APICAL MERISTEM PROTEIN
3swm_A5e-481315722170NAC domain-containing protein 19
3swm_B5e-481315722170NAC domain-containing protein 19
3swm_C5e-481315722170NAC domain-containing protein 19
3swm_D5e-481315722170NAC domain-containing protein 19
3swp_A5e-481315722170NAC domain-containing protein 19
3swp_B5e-481315722170NAC domain-containing protein 19
3swp_C5e-481315722170NAC domain-containing protein 19
3swp_D5e-481315722170NAC domain-containing protein 19
4dul_A5e-481315719167NAC domain-containing protein 19
4dul_B5e-481315719167NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755176e-87HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015159594.11e-138PREDICTED: transcription factor JUNGBRUNNEN 1-like
SwissprotQ9SK555e-85NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLM0ZL441e-138M0ZL44_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000030821e-138(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16972469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.14e-84NAC domain containing protein 42